PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_04784.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 345aa    MW: 38647.2 Da    PI: 7.7778
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_04784.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding538e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g W+++Ede+l++ ++ +G g+W+++++  g+ R++k+c++rw +yl
  Rsa1.0_04784.1_g00003.1 14 KGLWSPDEDEKLLNHITNHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                             678*******************************************97 PP

2Myb_DNA-binding48.71.7e-1567110146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg++++eE+ l+v++++ lG++ W+ Ia++++ gRt++++k+ w++
  Rsa1.0_04784.1_g00003.1  67 RGAFSPEEENLIVQLHAVLGNR-WSQIAAKLP-GRTDNEIKNLWNS 110
                              89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-26664IPR009057Homeodomain-like
PROSITE profilePS5129417.147961IPR017930Myb domain
SuperFamilySSF466891.54E-2812108IPR009057Homeodomain-like
SMARTSM007172.8E-111363IPR001005SANT/Myb domain
PfamPF002491.7E-141461IPR001005SANT/Myb domain
CDDcd001671.60E-101761No hitNo description
PROSITE profilePS5129425.28862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2565117IPR009057Homeodomain-like
SMARTSM007171.1E-1366114IPR001005SANT/Myb domain
PfamPF002494.3E-1467110IPR001005SANT/Myb domain
CDDcd001671.87E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPD EDEKLLNHIT NHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SPEEENLIVQ LHAVLGNRWS QIAAKLPGRT DNEIKNLWNS NIKKKLKQRG  120
IDPNTHKPIS EVDKDKPTTS SNDHMSLSSS SATNQDFYLE RPSDFSDYFG PQKLNFNSNL  180
GLSVDSSLCS MIPVQFIPGN KVGSVFQTPS CVKPSISLPP DNSSSTDHAA PNWEFQTNNT  240
SSFTDNGGFT WSVPNSSPSL VKPNHNFEEL KWSEYLNAPF FNGSTVQSQI SLPIFIKSEV  300
DYLANVSSLA DPWSQSQNEN LNTPEANDVF CKDLQRMAVS FGQSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667410.0KC966741.1 Brassica napus MYB transcription factor 61 (MYB61.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009118313.10.0PREDICTED: transcription repressor MYB6-like isoform X1
RefseqXP_013716191.10.0PREDICTED: transcription factor MYB86-like
TrEMBLM4ES910.0M4ES91_BRARP; Uncharacterized protein
STRINGBra031669.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.10.0myb domain protein 61